Immun
LL-37 (Cathelicidin)
Antimikrobiell
The only human cathelicidin. Broad-spectrum antimicrobial, anti-biofilm, and wound healing peptide. Also modulates innate immunity, promotes angiogenesis and accelerates skin wound closure.
Aminosäuren37
Mol. Gewicht4493.3 Da
Halbwertszeitca. 1–2 Stunden
Verfügbarkeit
🔔 Auf Anfrage
Aminosäuresequenz
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
What Is LL-37?
LL-37 is the only member of the cathelicidin family expressed in humans, derived from the C-terminal region of the precursor protein hCAP18. Produced by neutrophils, epithelial cells, and keratinocytes, it serves as a first-line antimicrobial defence and key wound healing mediator.
Schlüsselmechanismen
- Membrane disruption — electrostatic interaction with bacterial membranes; kills broad-spectrum Gram+ and Gram− bacteria
- Anti-biofilm — disrupts established biofilms at sub-MIC concentrations
- FPRL-1 receptor signalling — induces angiogenesis, cell migration and wound closure
- Innate immune modulation — reduces LPS-driven TLR4 activation; prevents endotoxic shock
- Antiviral activity — inhibits HIV, influenza, HSV envelope fusion
Wichtige Referenzen
- Vandamme D et al. “A comprehensive summary of LL-37, the factotum human cathelicidin peptide.” Cell Immunol, 2012;280:22–35.
- Ramos R et al. “Wound healing activity of LL-37 is abrogated by DHP-2.” Biochimie, 2011;93(2):234–238.