Home / Peptide Wiki / LL-37 (Cathelicidin)
Immune

LL-37 (Cathelicidin)

Antimicrobial

The only human cathelicidin. Broad-spectrum antimicrobial, anti-biofilm, and wound healing peptide. Also modulates innate immunity, promotes angiogenesis and accelerates skin wound closure.

Amino Acids37
Mol. Weight4493.3 Da
Half-Life~1–2 hours
Availability 🔔 By Request
Amino Acid Sequence [LL-37, 37 aa]

What Is LL-37?

LL-37 is the only member of the cathelicidin family expressed in humans, derived from the C-terminal region of the precursor protein hCAP18. Produced by neutrophils, epithelial cells, and keratinocytes, it serves as a first-line antimicrobial defence and key wound healing mediator.

Key Mechanisms

  • Membrane disruption — electrostatic interaction with bacterial membranes; kills broad-spectrum Gram+ and Gram− bacteria
  • Anti-biofilm — disrupts established biofilms at sub-MIC concentrations
  • FPRL-1 receptor signalling — induces angiogenesis, cell migration and wound closure
  • Innate immune modulation — reduces LPS-driven TLR4 activation; prevents endotoxic shock
  • Antiviral activity — inhibits HIV, influenza, HSV envelope fusion

Key References

  1. Vandamme D et al. “A comprehensive summary of LL-37, the factotum human cathelicidin peptide.” Cell Immunol, 2012;280:22–35.
  2. Ramos R et al. “Wound healing activity of LL-37 is abrogated by DHP-2.” Biochimie, 2011;93(2):234–238.
🔬

Request Peptide

Fill out the form and we'll get back to you within 24 hours.